HORDB

ID: hor000887
Uniprot ID: P11242(65-123)
Protein name: Galanin message-associated peptide
Gene name: GAL
Organism: Bos taurus (Bovine)
Family: Galanin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031763 galanin receptor binding; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence: ELEPEDEARPGSFDRPLAENNVVRTIIEFLTFLHLKDAGALERLPSLPTAESAEDAERS
Length: 59(65-123)
Propeptide: MPRGSVLLLASLLLAAALSATLGLGSPVKEKRGWTLNSAGYLLGPHALDSHRSFQDKHGLAGKRELEPEDEARPGSFDRPLAENNVVRTIIEFLTFLHLKDAGALERLPSLPTAESAEDAERS
Signal peptide: MPRGSVLLLASLLLAAALS
Modification: T52 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: May regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.
Mechanism: NA
Cross BBB: NA
Target: GALR1, GALR2
Target Unid: E1BCM7, A6QLK3
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000887_AF2.pdb

hor000887_ESM.pdb

Mass:	759895	Formula:	C287H455N79O97
Absent amino acids:	CMQWY	Common amino acids:	E
pI:	4.07	Basic residues:	7
Polar residues:	11	Hydrophobic residues:	22
Hydrophobicity:	-52.37	Boman Index:	-14161
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	87.8
Instability Index:	5707.8	Extinction Coefficient cystines:	0
Absorbance 280nm:	0